P48023

356

17.31 kDa

30-35 kDa

soluble Fas Ligand (sFasL), TNFSF6, CD95L, Apo I Ligand, APTL, APT1LG1, CD178

Measure by its ability to induce apoptosis in Jurkat cells. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant human FasL is > 1 x 106 IU/mg.

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei

>98% as determined by SDS-PAGE. Ni-NTA chromatography

His-SUMO tag at the N-terminus

Escherichia coli

FasL is a member of the TNF superfamily, and is mainly expressed on the cell surface of activated T cells. FasL induces apoptosis in Fas-bearing cells by binding to Fas Receptor. FasL has the ability to leads to down-regulation of the immune response through killing T cells and activated B cells. The mechanism of Fas-induced apoptosis involves recruitment of pro-caspase 8 through an adaptor molecule called FADD, followed by processing of the pro-enzyme into active forms. These active caspases then cleave various cellular substrates, leading to the eventual cell death.

The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

<0.1 EU per 1 μg of the protein by the LAL method.

Cell culture,Elisa

QIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL with polyhistidine tag and sumo tag at the N- terminus